PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_66539.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Nin-like
Protein Properties Length: 580aa    MW: 63276.7 Da    PI: 6.2048
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_66539.5genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.62.8e-29230281152
        RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  MLOC_66539.5 230 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 281
                   589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.746220301IPR003035RWP-RK domain
PfamPF020421.8E-26233281IPR003035RWP-RK domain
SuperFamilySSF542772.55E-22477570No hitNo description
SMARTSM006662.2E-24486568IPR000270PB1 domain
PfamPF005643.0E-15486567IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.1E-26486567No hitNo description
PROSITE profilePS5174519.189486568IPR000270PB1 domain
CDDcd064071.39E-34487567No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MGEVCMSTSD VAFHVIDAHM WGFRDACVEH HLQKGQGVSG KAFIYHRPCF SKDISQFCKL  60
EYPLVHYARM FGLAGCFAIC LQSPYTGDDY YMLEFFLPPS CKDEDDQNAL LESILGLINQ  120
CLRNLKVAGN GESNEASLQL SNVIRIENED FKTVHFENSE GFHESPEGDT HGGAHEFDKG  180
NSKVSEGHLL ADDNSQNNGT SVSRPNGSAA SDSSLLHKNS KPPERRRGKA EKTISLEVLQ  240
QYFSGSLKNA AKSLGVCPTT MKRICRQHGI SRWPSRKINK VNRSLSKLKQ VIESVQGSDA  300
AFNLTSITGP LPTIPVGPSS DSFNKEKASE SKAEHSNRAV DGDRDSSLQK SQENGSHFGG  360
LMSQQGFADT GNNAQLEADK ASLSRSSSGE GSINSRTSEG SCQGSPANQT FVCQPIASMF  420
LEPQEPQPNP EGFTKEPFQE PELPLSRMLI EDSGSSKDLK NLFGSAIGQP MLAPPSNFGP  480
MRNSGTVTIK ASFKEDIVRF RFPCSSSVMA LKDEVAKRLR MDAGMFDIKY LDDDHEWVKL  540
ACNADLEECI EISRHSGTHV IRLLVSDVAA HIGSSCGSSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565547.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLM0Y7R40.0M0Y7R4_HORVD; Uncharacterized protein
STRINGMLOC_66539.50.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-104Nin-like family protein